Protein Info for DZA65_RS00660 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 287 to 314 (28 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 40 to 257 (218 residues), 107.4 bits, see alignment E=1.3e-34 PF02687: FtsX" amino acids 295 to 407 (113 residues), 67 bits, see alignment E=1.6e-22

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 84% identity to dze:Dd1591_3982)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVR2 at UniProt or InterPro

Protein Sequence (414 amino acids)

>DZA65_RS00660 ABC transporter permease (Dickeya dianthicola ME23)
MVVSGRRPVRERLSSGYGPSLRQRLTEPLESLRMLGRRAVLALLGIAVGCGAVVALINVG
HNAEAQAMAVFRNMGSDLLVANIQFPAGSQPPRYVPDTLDTAALREALPDILAASALIMT
SVESRLQGRRFNTMVVGVNPAFSLVLDLRIAQGRFLSQYDAHSTHAVLGARVVTELLAKG
IPVTLGDRVQLGGYLFQVVGILQARGQNPMMAVSVDDSILVPIEGMRRIVPSPQINTLLA
RNRRSETLEQVAPQLQARLQALLPGRQIDVQIPQQLLAGIAQQSRLFSWLLAGLGGISLL
VGGVGVMNVMLMNVAERRREIGVRMALGARPRDIASLFLLEAVALTAAGALVGAVGGIGA
AWFFVTVSGWAGFTLSPFSLCLGVGSSVLAGLFFGLTPALSAARLQPVQALRDE