Protein Info for DZA65_RS00595 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 13 to 103 (91 residues), 46 bits, see alignment E=5.6e-16 PF00528: BPD_transp_1" amino acids 115 to 335 (221 residues), 139.9 bits, see alignment E=8.1e-45

Best Hits

Swiss-Prot: 43% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 98% identity to ddc:Dd586_0118)

MetaCyc: 41% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C947 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DZA65_RS00595 ABC transporter permease (Dickeya dianthicola ME23)
MQILTRFCSTLGSLLLTLLGLSVLTFFIGRIMPTDPVLAAVGDNAPQAVVERVRQEMGLD
QPLWMQYGHYLNQLLHGDLGRSVLTSNPVTTDIARYFPATLELATAAIIVAALVGIPLGV
WAAVRQGRWVDQVIRIICLAGHSLPVFVLALLSLLIFYAVLGIAPGPGRQDILFQDMVPH
VTGLLTVDALLAGDYDALRDALAHMVQPVLILAYFSMAYITRMTRTFMLNALSGEFVITA
RAKGLSSRRVVWRHAFPTVAVQLVTVLSLTYAGLLEGAVVTENVFSWPGLGQYLTTALLN
ADMNPVVGATLLVGAVYVLLNLLADIFYRLLDPRVT