Protein Info for DZA65_RS00520 in Dickeya dianthicola ME23

Annotation: acyl-homoserine-lactone synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00765: Autoind_synth" amino acids 9 to 187 (179 residues), 298.8 bits, see alignment E=1.3e-93 PF21926: FeeM" amino acids 19 to 144 (126 residues), 28.5 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 96% identical to ECHI_DICCH: Acyl-homoserine-lactone synthase (echI) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 97% identity to ddc:Dd586_0112)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XV61 at UniProt or InterPro

Protein Sequence (212 amino acids)

>DZA65_RS00520 acyl-homoserine-lactone synthase (Dickeya dianthicola ME23)
MLEIFDVSFSLMSNNKLDEVFTLRKDTFKDRLDWAVNCINGMEFDEYDNEHTTYLLGVKE
GKVICSVRFIEIKYPNMITGTFFSYFDNLKIPEGNYIESSRFFVDRDRVRNLIGTRNPAC
LTLFLAMINYARKYHYDGILTIVSHPMLTLLKRSGWRISIIQQGLSEKQEKIYLLHLPAD
DESRYALIERITQITSAESEQLKTLPLLVPLA