Protein Info for DZA65_RS00430 in Dickeya dianthicola ME23

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 335 to 438 (104 residues), 66 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_0094)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XRX7 at UniProt or InterPro

Protein Sequence (439 amino acids)

>DZA65_RS00430 histidine kinase (Dickeya dianthicola ME23)
MSKLDSSFEPPHLLSFNVAAIAGLLGYFLLWLFPDQSVYLKILTVFIIFLCLVYSSFTFS
ERLNGKIHVVSNLLEALEQENFSLRGVTKGKGAFDNLIRQINQLSGAMARSRQQQKETYY
VLHKVISNINISVFALDAERRIIWCNDAAAALVNKPLSLLVGQPAAEFGLEGLLQQPSDA
EPVDWRFPGTRGMFQIRHDSFIEDGRQNHLLFISDVSKLLRNEEQKTWQNLLRVISHEIN
NSLTPIASISQTLLQVFRKDNQHQAAPDLVNGMEIINNRARELITFVGSYRQLNRLPPAN
KQPCDIAGLMMQMAMLFPQRKLIFSGDAPQQAMVDANQMQQIFINLLKNADEAMEPGLGE
IVLRWKVIARQLHIEIIDQGKGVANIENLFVPFYTTKTHGSGIGLILCRQIVEGHDGHLT
LENRKDAEGCVVNIFLPLG