Protein Info for DZA65_RS00405 in Dickeya dianthicola ME23

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 121 to 218 (98 residues), 29.6 bits, see alignment E=6.6e-11 PF00561: Abhydrolase_1" amino acids 124 to 228 (105 residues), 35 bits, see alignment E=1.9e-12 PF12697: Abhydrolase_6" amino acids 125 to 272 (148 residues), 41.8 bits, see alignment E=2.9e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_00967)

Predicted SEED Role

"FIG00613624: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CM34 at UniProt or InterPro

Protein Sequence (362 amino acids)

>DZA65_RS00405 alpha/beta hydrolase (Dickeya dianthicola ME23)
MLLYNLCYPLMWLATLVQYNYYRLLVKLKRRPSLLLKVRIKPETHYIRLCRVLRLADLWL
LERCSPHLAARYLLHLFETTRYISYKQMDHDYLAGFRQETVCFQRQNVYVFRWVPPPADT
PAKNVLLVHGWEGRGIMFRMLCEALKAQGYGVVMPDLLAHGLSEGKRVSSYELASLLIRL
GQRYGPFCAVVGHSSGGLVCSLALAQGLAAERLVLLASPDNFGKMIDQFLAGASVSASLA
APMKAIYARRFGFHPDQVGEALYRTLDCPALICHDWQDVRVHPQVADEIHQAFAHSEVFY
TRGLGHLGILRSPLVHQRILSFLSDAGAGTERRIPPHIPYSIMPDDADSSRYGPVPTASK
RI