Protein Info for DZA65_RS00355 in Dickeya dianthicola ME23

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR00032: argininosuccinate synthase" amino acids 13 to 419 (407 residues), 555.4 bits, see alignment E=4.5e-171 PF00764: Arginosuc_synth" amino acids 14 to 161 (148 residues), 69.2 bits, see alignment E=4.5e-23 PF20979: Arginosuc_syn_C" amino acids 191 to 408 (218 residues), 108.6 bits, see alignment E=3.5e-35

Best Hits

Swiss-Prot: 99% identical to ASSY_DICD3: Argininosuccinate synthase (argG) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 99% identity to ddd:Dda3937_00977)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCJ3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>DZA65_RS00355 argininosuccinate synthase (Dickeya dianthicola ME23)
MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEDDYDAIPRRA
KEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGMTYFNTTPLGRAVTGTMLVAAMKE
DDVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFIDELGGRQEMSEFMTTSG
FDYKMSAEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDENVRIPVEEVTVR
FERGHPVALNGQTFSDDVELMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HIAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDPQALMLRDALQRWVASEITGEV
TLELRRGNDYSILNTVSDNLTYKPERLTMEKGESVFSPDDRIGQLTMRNLDITDTREKLF
NYVESGLISSGNAGLPQVANPPLQDKSAK