Protein Info for DZA65_RS00310 in Dickeya dianthicola ME23

Annotation: xylose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR02630: xylose isomerase" amino acids 4 to 437 (434 residues), 714.6 bits, see alignment E=2.2e-219 PF27526: XylA2_C" amino acids 383 to 437 (55 residues), 74.3 bits, see alignment 3.7e-25

Best Hits

Swiss-Prot: 88% identical to XYLA_PECAS: Xylose isomerase (xylA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01805, xylose isomerase [EC: 5.3.1.5] (inferred from 97% identity to ddc:Dd586_0071)

MetaCyc: 82% identical to xylose isomerase (Escherichia coli K-12 substr. MG1655)
Xylose isomerase. [EC: 5.3.1.5]

Predicted SEED Role

"Xylose isomerase (EC 5.3.1.5)" in subsystem Xylose utilization (EC 5.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D6A5 at UniProt or InterPro

Protein Sequence (439 amino acids)

>DZA65_RS00310 xylose isomerase (Dickeya dianthicola ME23)
MHAYFDQIEKVRFEGQGSRNPFAFRHYNPDEVILGKRMADHLRFAVCYWHTFCWNGADMF
GAGAFARPWQQSGDALALAKRKADIAFEFLHKLGAPYYCFHDVDVAPEGGSLQEYLNNFA
AMTEVLAAKQQETGVKLLWGTANCFTNPRYAAGAATSPDPDVFAWAATQVFTAMNATKTL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFHHEIATAIALGIFGSVDTNRG
DPQLGWDTDQFPNSVEENALVLYEILKAGGFTTGGLNFDAKVRRQSTDRYDLFHAHIGAM
DTLALSLKVAARMLEDGELNQQVANRYAGWNSELGQQILQGNASLEMLAGYAVRHQLDPQ
HHSGQQERLENLVNRYLFG