Protein Info for DZA65_RS00155 in Dickeya dianthicola ME23

Annotation: alkylhydroperoxidase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR04030: alkylhydroperoxidase domain protein, Avi_7169 family" amino acids 181 to 367 (187 residues), 300.6 bits, see alignment E=9.9e-94 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 196 to 367 (172 residues), 150.4 bits, see alignment E=8.9e-48 PF02627: CMD" amino acids 233 to 294 (62 residues), 42.8 bits, see alignment E=2.1e-15 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 248 to 291 (44 residues), 39.7 bits, see alignment 5.2e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_01025)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XRY2 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DZA65_RS00155 alkylhydroperoxidase domain protein (Dickeya dianthicola ME23)
MTQSASDILDTLAEIAPDSPLAQARATRDAATRHTQGSYEALFNHTEDGGLPLALRFFIA
EKVSGWHQNARLQRFYAQRLADFPAPAPGAALDRALEQAERLAFQPVTAQPESLQALQQA
GWAVDDIVTLSQLVAFVSFQSRLLHGYRLLAGHAEDPAPAAPAAIAGRWHTQAQTHSGKT
APDAFTQGELGWEPWVPAKPLAAFTADEQAILARFGHTDSDYFRLLGRNLPVLEQRTLTD
KGIFYTSGGLPRKDRELAAAVVSKVNGCIYCASVHARKASQLSKQDDAVQRLLDVPPGGD
LAAGQDARWQAIITFAAQLSTTPSQTNARDLARLREQGLDTLEILDLIQSAAFFAWANRL
MLTLGEPFWPVR