Protein Info for DZA65_RS00125 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 333 to 359 (27 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 383 (357 residues), 112.5 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K08177, MFS transporter, OFA family, oxalate/formate antiporter (inferred from 91% identity to ddd:Dda3937_01032)

Predicted SEED Role

"oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D970 at UniProt or InterPro

Protein Sequence (435 amino acids)

>DZA65_RS00125 MFS transporter (Dickeya dianthicola ME23)
MSETITTQKRTDKEILGFNRWWLFVLAFLAMSVISPYEYAWSVIAPHFAKIYGWEPTKIS
LMFTMFVIFQAFGTLPGGIFRDKFGPKAVSVVAGIFSGIGLLVCAFGQIFSYKVVLIVWC
IGCFFCGFTYNVAITTCNKWFPDHRNITIGLISAAFSWGALPFIFPIRSIPEDAPDNIFF
NVIFIMAAIIAGVIIITGLLMKDPPKGWSYFSPLATTKNKLAKRPCEKQYSMGEAMHTWQ
FWVLIASFVLVSASGLTFISNSIKFASAFHFSLTAGTVVTVGMAITSGLSRVVGGWIADK
IGIDKTMTLFYILCGLFSLIALFFAEAGSANGFISSCIISIFFWGALYSLFASIVGYYYG
EVASGSNYGMLYASAKGLGGIYGGVLSAYLIATYGHPFTIIVSSVMALLSGCILIPLWKH
PPVWKETHEILITTH