Protein Info for DDA3937_RS21115 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF00005: ABC_tran" amino acids 36 to 194 (159 residues), 104.4 bits, see alignment E=5.5e-33 amino acids 327 to 477 (151 residues), 120.3 bits, see alignment E=6.5e-38 PF13304: AAA_21" amino acids 126 to 228 (103 residues), 39.3 bits, see alignment E=4.9e-13 PF08352: oligo_HPY" amino acids 246 to 286 (41 residues), 20.2 bits, see alignment 4e-07 amino acids 529 to 554 (26 residues), 19.7 bits, see alignment (E = 6e-07)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_01022)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SNB7 at UniProt or InterPro

Protein Sequence (560 amino acids)

>DDA3937_RS21115 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MSLPLSLQSSTTTPVLELEDVAIAYRGDDGERTVVEGVSFAIQPGEVVALVGESGSGKTT
TAQAVIGLLADNGRLTRGAIRLNGADISRWSQPRLDSIRGRVVSLVPQDPGSSLNPVKTI
GEQVDEILRLHQKSDRHSLRRQTLALLTRVGLTEPELRAGQYPHELSGGMKQRVLIAIAI
ALKPALIIADEPTSALDVTVQKRILDLLDELRRENGTAILFVTHDLGVAAERADRLLVFQ
KGYIQEQGPTQQVLSAPQSQYARTLLANIPSLAPARRPSRAAASGQPISCKPIPSQPIPC
ELIVQVEQLVQEFPPAGNRKQPFRAVDAVSFSVAPGTTHAIVGESGSGKTTTARMILGFQ
RPTAGRILIDGTDITRLRGEALRQFRQTIQLVYQNPFSSLDPSQRLFDIVEEPLRNFNRY
ARAERANRVHEIFERVALPASLLQRRPAELSGGQRQRVAIARALVLAPKVLVLDEAVSAL
DVTVQAQILRLLEELQASLGLTYLFISHDLAVVRQIADTVSVLYHGKQVESGPVEQIFAQ
PAERYTRELIDAIPGQRHVS