Protein Info for DDA3937_RS20060 in Dickeya dadantii 3937

Annotation: ECA polysaccharide chain length modulation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details PF02706: Wzz" amino acids 14 to 65 (52 residues), 43.2 bits, see alignment 2.1e-15

Best Hits

Swiss-Prot: 54% identical to WZZE_SHIFL: ECA polysaccharide chain length modulation protein (wzzE) from Shigella flexneri

KEGG orthology group: K05790, lipopolysaccharide biosynthesis protein WzzE (inferred from 100% identity to ddd:Dda3937_00269)

MetaCyc: 54% identical to enterobacterial common antigen polysaccharide co-polymerase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"regulator of length of O-antigen component of lipopolysaccharide chains" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKQ6 at UniProt or InterPro

Protein Sequence (344 amino acids)

>DDA3937_RS20060 ECA polysaccharide chain length modulation protein (Dickeya dadantii 3937)
MKPETSPQPMSPDNELDIRRLCRALWQGKMWIVGSAALFALLALMYSWLAQPVWRTTAVT
DKPTAAMLSTFFDQQQWLRSLDAPTAAIPDGSAIMADAYTEFTMQAAAYDTRREFWLQSA
YYRARQKGDDKADAVLLDVLINDIQFMPRDDAKKTNDTLKLGADNAQDASNLLRQYVQFA
NQRAVNHLNQSLAGSWAARVRFERAWLQREDTAARAVYDRTLQRLTQALAIARQQGIVQP
KNEASLPLPDSEWFLQGSAQLQASLEMLKAGGPTFDADYEPRRAALAMLENGPALADRFQ
TYRYLHTPEEPVQRDSPRRSFLLLMWGSIGLLVGAGLALARRSR