Protein Info for DDA3937_RS18985 in Dickeya dadantii 3937

Annotation: outer membrane lipoprotein Blc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08212: Lipocalin_2" amino acids 34 to 172 (139 residues), 145.3 bits, see alignment E=1.4e-46 PF00061: Lipocalin" amino acids 39 to 169 (131 residues), 31.4 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 66% identical to BLC_ECOLI: Outer membrane lipoprotein Blc (blc) from Escherichia coli (strain K12)

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to ddd:Dda3937_02143)

Predicted SEED Role

"Outer membrane lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SI31 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DDA3937_RS18985 outer membrane lipoprotein Blc (Dickeya dadantii 3937)
MTYWRVIFTTAVALFSIACSTTPPRGVQVVDNFELSRYMGTWYEIARLDNRFERGLEQVT
ATYSPREDGGITVVNRGFDPVKRVWRESIGKGYFTGSPQRAALKVSFFGPFYGGYNVIAL
DSDYRYALVCGPNRDYLWILSRTPEINPLVRQALLATAQRNGFQTDNLIWVNPFAGLGK