Protein Info for DDA3937_RS18615 in Dickeya dadantii 3937

Annotation: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00174: tRNA dimethylallyltransferase" amino acids 12 to 299 (288 residues), 382.1 bits, see alignment E=7.8e-119 PF01715: IPPT" amino acids 46 to 288 (243 residues), 299.2 bits, see alignment E=2.6e-93

Best Hits

Swiss-Prot: 82% identical to MIAA_PECAS: tRNA dimethylallyltransferase (miaA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to ddd:Dda3937_00435)

MetaCyc: 77% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SH72 at UniProt or InterPro

Protein Sequence (313 amino acids)

>DDA3937_RS18615 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA (Dickeya dadantii 3937)
MNEFEAVQHPPAIFIMGPTASGKTALAMALRERLPVELISVDSALIYRGMDIGTAKPSQE
ELARAPHRLLDILDPAEAYSAADFRRDALQAMAEITAAGRIPLLVGGTMLYFKALLEGLS
PLPSADAQVRQEIEERARIEGWEALHRQLSVIDPVSAARIHPNDPQRLSRALEVFFVSGN
TLTELTKTSGEALPYRVHQFAIAPATRELLHERIALRFRQMLESGFETEARALFARPDLN
PALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLAKRQMTWLRGWEEVCWLDSDRP
GEALCTVIQAVSA