Protein Info for DDA3937_RS18565 in Dickeya dadantii 3937

Annotation: YqgE/AlgH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF02622: DUF179" amino acids 12 to 174 (163 residues), 176.6 bits, see alignment E=1.8e-56

Best Hits

Swiss-Prot: 84% identical to Y3712_PECCP: UPF0301 protein PC1_3712 (PC1_3712) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 100% identity to ddd:Dda3937_00425)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SH62 at UniProt or InterPro

Protein Sequence (187 amino acids)

>DDA3937_RS18565 YqgE/AlgH family protein (Dickeya dadantii 3937)
MNLQHHFLIAMPSLQDPVFRRTVIYICEHNEDGAMGLIINKPMEQFTVENILKKLKITPN
PRDTTIRLDKPVFSGGPLADDRGFILHTPLPGFASSISISDETMITTSKDVLETLGTPEQ
PSNTLVALGYSAWESGQLEEELLENAWLTVQADHHLLFHTPIAERWRAAAKKLGVDIHNI
AAEAGHA