Protein Info for DDA3937_RS17890 in Dickeya dadantii 3937

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00756: Esterase" amino acids 27 to 212 (186 residues), 56.8 bits, see alignment E=3e-19 PF00326: Peptidase_S9" amino acids 125 to 178 (54 residues), 24.4 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02638)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFF9 at UniProt or InterPro

Protein Sequence (283 amino acids)

>DDA3937_RS17890 alpha/beta hydrolase (Dickeya dadantii 3937)
MYQLSNTQVETFASAACGHYRLLTAWPDGPAPEQGWPVMYLLDGERYFASAVSQLAAMRE
PRCGMMPGVMVAIDYDGPTRRDRDYRPAVERLIPESDPAGGLRSPGELGDAAGFRRFLLE
ELKPFIQQRYDIDSQRQALFGHSYGGLFTVDTLFEQPGSFQHFYASSPSVWWNGGYLSRQ
AEAFIARVDVRPLHRPVRLALSVGEHEQSLEAWERRLPEARQCWLRQHRGQRRMVDGIRE
LATQLRLKTPLLEVTLQVHAEQSHMSASFPALLHALRHHFQPS