Protein Info for DDA3937_RS17770 in Dickeya dadantii 3937

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 273 (260 residues), 177.5 bits, see alignment E=1.9e-56

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 100% identity to ddd:Dda3937_03088)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFD7 at UniProt or InterPro

Protein Sequence (284 amino acids)

>DDA3937_RS17770 metal ABC transporter permease (Dickeya dadantii 3937)
MMLIHLLTEPFGDFGFMRRALVGCLALTLSAAPLGCFLLLRRMSLIGDALSHAVLPGVAI
GYLISGMSLVAMGVGGFIAGLAVAMLSGVVSRHTELKEDASFAGFYLGSLALGVTLVSLR
GSSVDLLHVLFGSILAIDANALITIGVISSCSVLVLALIYRALVIESFDVTFLKILSRRS
RALIHGLFLSLVVLNLVAGFQLLGTLMAVGMMMLPAACARFWSHRLPVMLLTAVGIGACA
SLVGLTWSYYADLPAGPAVILTTTLLFCFSVLFGSNGGMLRTHR