Protein Info for DDA3937_RS17215 in Dickeya dadantii 3937

Annotation: 50S ribosomal protein L9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR00158: ribosomal protein bL9" amino acids 1 to 149 (149 residues), 194.9 bits, see alignment E=4.8e-62 PF01281: Ribosomal_L9_N" amino acids 1 to 45 (45 residues), 77.6 bits, see alignment E=4.1e-26 PF03948: Ribosomal_L9_C" amino acids 63 to 148 (86 residues), 90.7 bits, see alignment E=6.8e-30

Best Hits

Swiss-Prot: 94% identical to RL9_PECCP: 50S ribosomal protein L9 (rplI) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 100% identity to ddd:Dda3937_00466)

MetaCyc: 91% identical to 50S ribosomal subunit protein L9 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SED6 at UniProt or InterPro

Protein Sequence (149 amino acids)

>DDA3937_RS17215 50S ribosomal protein L9 (Dickeya dadantii 3937)
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVEFFEARRAELEAKLAD
VLAAAEARAEKVNALASVTIASKAGDEGKLFGSIGTRDIADAITAAGVDVAKSEVRLPNG
VLRTLGEHEVSFQLHSDVFAKLNVVVVAE