Protein Info for DDA3937_RS17115 in Dickeya dadantii 3937

Annotation: SH3 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 173 to 195 (23 residues), see Phobius details TIGR04211: SH3 domain protein" amino acids 27 to 204 (178 residues), 175.9 bits, see alignment E=3.8e-56 PF08239: SH3_3" amino acids 37 to 80 (44 residues), 32.1 bits, see alignment 5.2e-12

Best Hits

Swiss-Prot: 63% identical to YGIM_ECOLI: Uncharacterized protein YgiM (ygiM) from Escherichia coli (strain K12)

KEGG orthology group: K07184, SH3 domain protein (inferred from 100% identity to ddd:Dda3937_00175)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDN9 at UniProt or InterPro

Protein Sequence (206 amino acids)

>DDA3937_RS17115 SH3 domain-containing protein (Dickeya dadantii 3937)
MNKLPLFLAAILGLSTTLGLHAEEKRYISDELATYTRSGPGNQYRIVGTLNAGEAVTLIS
ADAGAGYAQIRDEKGRTSWIQLDQLSQTPSLKTRVPELENQVKTLTDKLNSVDQDWNQRT
VDLRQKVAASDGTLTSLQKENQALKSQLEVAQKKLEVANLQLDDKQRTLIMQWFMYGGGV
AGAGLVLGLLLPHLLPRRKKNDRWMG