Protein Info for DDA3937_RS16680 in Dickeya dadantii 3937

Annotation: AtzE family amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02433, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit A [EC: 6.3.5.6 6.3.5.7] (inferred from 100% identity to ddd:Dda3937_00909)

Predicted SEED Role

"Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases"

MetaCyc Pathways

ammonia assimilation cycle III (3/3 steps found)
L-glutamate biosynthesis I (2/2 steps found)
L-glutamine degradation I (1/1 steps found)
L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
L-glutamate and L-glutamine biosynthesis (5/7 steps found)
L-citrulline biosynthesis (5/8 steps found)
superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCX2 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DDA3937_RS16680 AtzE family amidohydrolase (Dickeya dadantii 3937)
MNPAQLSIRALQAELAAGHLSAADIARDTLARIENDNPAINAYTGVTAQRMQAEAADIDR
KRRQGETLPALAAVPYAVKNLFDVAGETTLAGARLFSQRAPAAQDAFAVRQLQSSGALLS
GLLNMDAYAYGFTTENSHYGATRNPHDLTRIAGGSSGGSAAAVAAGLVNFSLGSDTNGSI
RVPASLCGIFGLKPTFGRLSRHGTQPFVGSLDHIGPLARSADDLAQVYNALLGLDPADRF
QADQPLRSTVASLANETPLRSRVLGGYFAQWCDEQAAAAVQQVATALQADDDAVLDNAAL
ARTAAFIVSASEGGNQYLPALRATPGLFEPLSRERLLAGAMIPAAWYVQAQRFRDHFRRD
VLALFADTDLLIAPATPCPATSIGQDTMRINHTDLPIRASMGMLTQPISFVGLPVVTVPL
VTASGLPIGVQLIAAPWREDVALRAAWRLEQLGIARVLPPASLNSQGASV