Protein Info for DDA3937_RS16605 in Dickeya dadantii 3937

Annotation: S-methyl-5-thioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 8 to 328 (321 residues), 408.9 bits, E=1.4e-126
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 34 to 329 (296 residues), 307.9 bits, E=7e-96
• PF01008: IF-2B
  • amino acids 48 to 329 (282 residues), 236.3 bits, E=2e-74

Best Hits

Swiss-Prot: 86% identical to MTNA_PECCP: Methylthioribose-1-phosphate isomerase (mtnA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 100% identity to ddd:Dda3937_00924)

MetaCyc: 80% identical to 5-methylthioribose-1-phosphate isomerase monomer (Klebsiella pneumoniae)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
• 5'-deoxyadenosine degradation II (3/4 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

See E0SCV7 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DDA3937_RS16605 S-methyl-5-thioribose-1-phosphate isomerase (Dickeya dadantii 3937)
MQTVNTTSLNVVDNQLWILDQQALPQEKIWCPCPDVDALVDHIRTLRVRGAPLIGLSASL
LLALLAEQGLSRPQLAQALETLRAARPTAVNLMNNLDRMKQALAADDFVNAMTQEALRLI
EEDKALCERIADNGAALVKPGSRLLTHCNTGGLATAGVGTAIGVMLRAHQQGNVEKVWVD
ETRPLLQGGRLTAWELGELGIPYHLICDSMAASLMAQGLVDAIWVGADRIAANGDVANKI
GTYSLAVLAHYHGIPFYVAAPHTTHDPHCPNGSAIPIEQRAASEVTGVAGSFGQCQWAPH
NAPVYNPAFDVTPAALISGWVLDGGVITPEQVRNGIFQHPLAG