Protein Info for DDA3937_RS14435 in Dickeya dadantii 3937

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 466 (465 residues), 541.1 bits, see alignment E=1.4e-166 PF13230: GATase_4" amino acids 64 to 184 (121 residues), 24.2 bits, see alignment E=3.1e-09 PF13522: GATase_6" amino acids 65 to 196 (132 residues), 55.2 bits, see alignment E=1.6e-18 PF13537: GATase_7" amino acids 81 to 215 (135 residues), 48.2 bits, see alignment E=2.2e-16 PF00156: Pribosyltran" amino acids 287 to 394 (108 residues), 27.3 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 86% identical to PUR1_SHIFL: Amidophosphoribosyltransferase (purF) from Shigella flexneri

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to ddd:Dda3937_02099)

MetaCyc: 86% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SL85 at UniProt or InterPro

Protein Sequence (505 amino acids)

>DDA3937_RS14435 amidophosphoribosyltransferase (Dickeya dadantii 3937)
MCGIVGIAGFTPVNQSIYDALTVLQHRGQDAAGIVTINDANYFRLRKANGLVKDVFEARH
MQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPFGITLAHNGNLTNAHELRKKLFEEGR
RHVNTTSDSEILLNVFAKELDRFQHYPLEADNIFAAVAAVHQQIRGAYACIGMIIGHGMV
AFRDPNGIRPLVIGKRELPDGRNEYIVASESVALDTLGFEFLRDVAPGEAVYITENGQLF
TRQCAENPKSHPCLFEYVYFARPDSFIDKISVYSARVRMGQKLGEKIARQWEELDIDVVI
PIPETSCDIALEIARIINKPYRQGFVKNRYVGRTFIMPGQQTRIKSVRRKLNANRAEFRG
KNVLLVDDSIVRGTTSQQIVEMAREAGARRVYLASAAPEIRFPNVYGIDMPSVNELIAHG
REVEEIRKIIGADALIFQDLDDLIEAVREDNPEIVQFECSVFNGVYVTKDVDQDYLDYLE
ALRNDDAKAMRSQNEVEDLEMHNEG