Protein Info for DDA3937_RS12945 in Dickeya dadantii 3937

Annotation: lipoate--protein ligase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00545: lipoyltransferase and lipoate-protein ligase" amino acids 5 to 327 (323 residues), 394.6 bits, see alignment E=1.7e-122 PF03099: BPL_LplA_LipB" amino acids 53 to 157 (105 residues), 25.3 bits, see alignment E=1.2e-09 PF10437: Lip_prot_lig_C" amino acids 250 to 333 (84 residues), 69.3 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 76% identical to LPLA_PECCP: Lipoate-protein ligase A (lplA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03800, lipoate-protein ligase A [EC: 2.7.7.63] (inferred from 100% identity to ddd:Dda3937_03650)

MetaCyc: 75% identical to lipoate--protein ligase A (Escherichia coli K-12 substr. MG1655)
RXN-17127 [EC: 6.3.1.20]; 6.3.1.20 [EC: 6.3.1.20]; 6.3.1.20 [EC: 6.3.1.20]

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.63 or 6.3.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGY0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DDA3937_RS12945 lipoate--protein ligase A (Dickeya dadantii 3937)
MPALRLLISDSVDPWFNLAVEECIFRQMPTTQRVLFLWRNAETVVIGRAQNPWKECNTRR
MEQDGIKLARRSSGGGAVFHDLGNTCFTFMAGKPGYDKSVSTGIILRALATCGVTAQASG
RNDLVVETVDGVRKISGSAYRESADRGFHHGTLLLAANLSRLADYLNPDVKKLQAKGIAS
VRSRVANLVELLPEISHETVCDAITQAFFEHYQTRCQPEIISPDVLPDLPGFAELFARQS
SWAWNFGQAPEFSHMLDTRFDWGGVELHFDVERGVISRCQLFTDSLNPTPLEALAERLEG
VSYRPDALLVVGERLAVDFPQQHNEINALIVWLSEGIR