Protein Info for DDA3937_RS12445 in Dickeya dadantii 3937

Annotation: peptide ABC transporter permease SapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 77 to 102 (26 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 311 (220 residues), 124.5 bits, see alignment E=2.1e-40

Best Hits

Swiss-Prot: 75% identical to SAPB_SALTI: Peptide transport system permease protein SapB (sapB) from Salmonella typhi

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to ddd:Dda3937_03112)

MetaCyc: 74% identical to putrescine ABC exporter membrane subunit SapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system permease protein sapB (TC 3.A.1.5.5)" in subsystem ABC transporter peptide (TC 3.A.1.5.5) (TC 3.A.1.5.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFZ6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>DDA3937_RS12445 peptide ABC transporter permease SapB (Dickeya dadantii 3937)
MIIFTLRRLLLLLVTLFLLSLIGFSLMYYTPHAPLNGAALLDAYRFYFTSLLQGDFGVSS
TNGQPISEQLRDVLPATIELCLLAFSLSLLVGIPLGITTGVLQHKTADRLISGLALLGFS
LPVFWLALLMTLFFSLHLGWLPVSGRFDLLYPVPQVTGFALIDAWLSDSPYRDEMIASAV
QHLILPVLVLSVGPTTEVIRLMRISTTDVGTQNYIKAAVIRGLPRSTVIRRHLLHNALPP
IIPQLGLQFSTMLTLEMITEVVFNWPGIGRWLVNAIRQQDFAAISAGVMVIGALVITINV
LSDIWGAMANPLKHKEWYALR