Protein Info for DDA3937_RS11265 in Dickeya dadantii 3937

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR00720: L-serine ammonia-lyase" amino acids 2 to 450 (449 residues), 745.6 bits, see alignment E=1e-228 PF03315: SDH_beta" amino acids 3 to 154 (152 residues), 207.2 bits, see alignment E=1.7e-65 PF03313: SDH_alpha" amino acids 183 to 447 (265 residues), 299.5 bits, see alignment E=2.4e-93

Best Hits

Swiss-Prot: 81% identical to SDHL_ECOLI: L-serine dehydratase 1 (sdaA) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to ddd:Dda3937_03721)

MetaCyc: 81% identical to L-serine deaminase I (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDA9 at UniProt or InterPro

Protein Sequence (453 amino acids)

>DDA3937_RS11265 L-serine ammonia-lyase (Dickeya dadantii 3937)
MISVFDMFKIGIGPSSSHTVGPMKAGKQFVDELQQRDLLSRTERVTVEVYGSLALTGKGH
HTDIAIILGLAGNQPDTVDIDAIPAFIRDVEQTERLSLAGTHEVAFPREGGMIFRGENLP
LHENGMTLTAFAADLPLFRQTYYSIGGGFIVDEAHFGQSQESTFTVPHPYRSAREILEHC
KQSGLSISGMMMRNELALHSRQEIEDYFAAVWQTMRACMDRGMNTEGVLPGPLRVPRRAA
ALRRILVSSDKLSNDPMNVVDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYYD
HFIEPVGPGIYLRYFMAAGAIGTLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGAS
PEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAINATRMAVRRTTEARVSL
DKVIETMYETGKDMNAKYRETSRGGLAIKVQCD