Protein Info for DDA3937_RS10995 in Dickeya dadantii 3937

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 417 (414 residues), 524.7 bits, see alignment E=8.6e-162 PF05201: GlutR_N" amino acids 6 to 156 (151 residues), 188.6 bits, see alignment E=8.5e-60 PF01488: Shikimate_DH" amino acids 172 to 306 (135 residues), 163.7 bits, see alignment E=4e-52 PF00745: GlutR_dimer" amino acids 320 to 416 (97 residues), 87.2 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 85% identical to HEM1_PECCP: Glutamyl-tRNA reductase (hemA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to ddd:Dda3937_00037)

MetaCyc: 78% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCL4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>DDA3937_RS10995 glutamyl-tRNA reductase (Dickeya dadantii 3937)
MTLLALGINHKTAPVSLRERVAFSPDRQGQALHSLLQQPLVQGGVLLSTCNRTELYLSVE
EQENRREQLIAWLCDYHRLSPDEIRKNLYWHEGNAAVSHLMRVASGLDSLVLGEPQILGQ
VKKAFADSQRERSLSGELERMFQKSFTVAKRVRTETDIGASAVSVAFAACTLARQIFESL
ADVNVLLVGAGETIELVSRHLREHRVKRMVIANRTRERAQVLAEEVGADVITLAELDAYL
PQADIVISSTASTLPIIGKGMMERTMKTRRNQPMLMVDIAVPRDIEPEVGRLPNIYLYSV
DDLQAIIQHNLAQRKAAAIQAESIVQQECSEFMAWLRAQAAVDTIRDYRSQADRLRDDMT
AKALAAIQNGGDVDAIVQELAHRLTNRLIHAPTRSLQQAARDGDLERLQILRDSLGLN