Protein Info for DDA3937_RS10800 in Dickeya dadantii 3937

Annotation: serralysin family metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF13688: Reprolysin_5" amino acids 68 to 230 (163 residues), 27.2 bits, see alignment E=1.2e-09 PF00413: Peptidase_M10" amino acids 101 to 200 (100 residues), 37.8 bits, see alignment E=5.6e-13 PF13583: Reprolysin_4" amino acids 159 to 232 (74 residues), 27.4 bits, see alignment E=7.8e-10 PF08548: Peptidase_M10_C" amino acids 260 to 479 (220 residues), 296.4 bits, see alignment E=3.3e-92 PF00353: HemolysinCabind" amino acids 344 to 379 (36 residues), 42 bits, see alignment 2.2e-14 amino acids 363 to 395 (33 residues), 38.6 bits, see alignment (E = 2.4e-13)

Best Hits

Swiss-Prot: 99% identical to PRTC_DICCH: Serralysin C (prtC) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03860)

Predicted SEED Role

"Secreted alkaline metalloproteinase (EC 3.4.24.-), PrtA/B/C/G homolog" in subsystem Protein secretion by ABC-type exporters (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC29 at UniProt or InterPro

Protein Sequence (479 amino acids)

>DDA3937_RS10800 serralysin family metalloprotease (Dickeya dadantii 3937)
MGKNLSLRQDDAQHALSANTSSAYNSVYDFLHYHDRGDGLTVNGKTSYSVDQAAAQITRE
NVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTF
TEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEE
YGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNG
HYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGG
NDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNI
LQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFR
NEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV