Protein Info for DDA3937_RS09800 in Dickeya dadantii 3937

Annotation: triphosphoribosyl-dephospho-CoA synthase CitG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR03125: triphosphoribosyl-dephospho-CoA synthase CitG" amino acids 33 to 298 (266 residues), 343.5 bits, see alignment E=4.6e-107 PF01874: CitG" amino acids 36 to 296 (261 residues), 270.5 bits, see alignment E=1e-84

Best Hits

Swiss-Prot: 70% identical to CITG_PECCP: Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (citG) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K05966, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 100% identity to ddd:Dda3937_00043)

Predicted SEED Role

"2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (EC 2.7.8.25)" (EC 2.7.8.25)

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.25

Use Curated BLAST to search for 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SAQ6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DDA3937_RS09800 triphosphoribosyl-dephospho-CoA synthase CitG (Dickeya dadantii 3937)
MPGLTHTESSVSSPLLTTLFPDATGALVAIPTIHQQVAAALTVEVMLTPKPGLVDRDNNG
AHRDMDVPLFQASIAALTPWFSRFTEAGMAHSALPITQLLPQVRPIGIAAEQAMLAATGG
VNTHKGGIFAFGLLCSAAGWLAGRRLQLTRGSLCQCAAQMSADLVRNELENSQHTATAGE
HLFRRHGLTGARGEAASGFATVRQYALPAYLHARAQGQDDDSALLQTLVVLMAHNPDTNV
VSRGGIEGLAFVQSRARALLSVGVTRPGLQDMNQALVERNISPGGSADLLALTWLLSHYP
HV