Protein Info for DDA3937_RS09685 in Dickeya dadantii 3937

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 TIGR00717: ribosomal protein bS1" amino acids 15 to 532 (518 residues), 792.3 bits, see alignment E=9.1e-243 PF00575: S1" amino acids 31 to 90 (60 residues), 28.6 bits, see alignment 3.1e-10 amino acids 116 to 183 (68 residues), 40.2 bits, see alignment E=7.5e-14 amino acids 202 to 272 (71 residues), 77.9 bits, see alignment E=1.3e-25 amino acids 287 to 359 (73 residues), 70.9 bits, see alignment E=2e-23 amino acids 373 to 446 (74 residues), 78.1 bits, see alignment E=1.1e-25 amino acids 461 to 532 (72 residues), 57 bits, see alignment E=4.1e-19 PF23459: S1_RRP5" amino acids 201 to 270 (70 residues), 27.1 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to RS1_DICD3: 30S ribosomal protein S1 (rpsA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 99% identity to dze:Dd1591_2339)

MetaCyc: 95% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37985 at UniProt or InterPro

Protein Sequence (569 amino acids)

>DDA3937_RS09685 30S ribosomal protein S1 (Dickeya dadantii 3937)
MDVKFKNPKIINMTESFAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAI
PVEQFKNAQGEIEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWLMLEKAYEESATV
TGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVV
SRRAVIESENSAERDQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRV
KHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQLGEDPWVAIAKRYPEGTKLTGRVTNLT
DYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQ
CKANPWQQFAETHNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVRE
YKKGDEIAAVVLQVDAERERISLGVKQLAEDPFNNYLSVNKKGAIVTGKVTAVDAKGATV
ELADGVEGYLRASEASRDRIEDATLVMSVGDEIEAKYTGVDRKNRVVSLSIRAKDEADEK
DAIASVNNKQEEGNFSNAMAEAFKAAKGE