Protein Info for DDA3937_RS09400 in Dickeya dadantii 3937

Annotation: metal ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 32 to 259 (228 residues), 257.9 bits, see alignment E=3.4e-81

Best Hits

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 100% identity to ddd:Dda3937_03491)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SMT2 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DDA3937_RS09400 metal ABC transporter substrate-binding protein (Dickeya dadantii 3937)
MTLTRSIRAVLAVALLASGTSQALAQSDPHTIVFGVAPGPYGDMVNQAIKPELTKKGYNV
VVREFSDYVQPNLALSNGSIDANLFQHTLYLDKFSADKGLKLTRLITVPTASMGFYSRKI
TSLDQLKKGDVITLSNDPTNLARGLRFLQSLGLITIKPNIDPTKASEKDIQDNPRELVFK
PLEAAQLPRTLDSVTASLVNGNFAIAAGLKLSSALKLETLDENLKNVIAVRTDDLDKPFV
KEIKAVVESPAYAAVINDPATMFSQFQRPDWMKAQTPTPAQ