Protein Info for DDA3937_RS09340 in Dickeya dadantii 3937

Annotation: IS110-like element ISEch3 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF01548: DEDD_Tnp_IS110" amino acids 6 to 145 (140 residues), 60.2 bits, see alignment E=2.1e-20 PF02371: Transposase_20" amino acids 211 to 288 (78 residues), 86.4 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 46% identical to TRA8_YEREN: Transposase for insertion sequence element IS1328 from Yersinia enterocolitica

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02183)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGS4 at UniProt or InterPro

Protein Sequence (339 amino acids)

>DDA3937_RS09340 IS110-like element ISEch3 family transposase (Dickeya dadantii 3937)
MQVSTLGIDLAKNVFQLHGVDNSGKTVLRKRLTRNAFLPFLAQLPPCLIGMEACASAHHF
ARRLMQYGHQVRLMPPSYVKPYVKRDKTDARDAEAICEAVARPNMRFVAVKSETQQAILA
LHTERDLLIRERVASTNSLRAMLAEFGVVMETGLSALYKTLPVILEDGENALTALTRRSA
ARQLTHLRELEHQIAEVERELSAWFHSQEACRRLEKVPGVGMLTATYMVAAVGDGSQFTS
SKQFAAWVGLTPKEHSSGGKQWLGPISKRGDRYFRYLLIHGARALAAVIERHRDKQTWFY
SLLKRKPFNVAVVAQAGRTARILWSMLRGGSEYREIAPV