Protein Info for DDA3937_RS08490 in Dickeya dadantii 3937

Annotation: CidB/LrgB family autolysis modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 134 to 165 (32 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details TIGR00659: TIGR00659 family protein" amino acids 5 to 227 (223 residues), 319.2 bits, see alignment E=6.8e-100 PF04172: LrgB" amino acids 12 to 224 (213 residues), 268 bits, see alignment E=2.6e-84

Best Hits

Swiss-Prot: 74% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03743)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK86 at UniProt or InterPro

Protein Sequence (232 amino acids)

>DDA3937_RS08490 CidB/LrgB family autolysis modulator (Dickeya dadantii 3937)
MLTYLWWSLPLTLVVFFGARKMAMTLKMPLLNPLLVSMLVIIPLLLVLDIPYNHYFSGSA
ILNSLLQPAVVALAFPLYEQLHQIRARWKSIISVCFIGSVTAIISGTVIALWLGASREIA
ASVLPKSVTTPIAMAVASSIGGIPAISAMCVILVGIVGAVLGHALFNRLKIHAKSARGLA
MGTASHALGTARCAEVDFQEGAFSSLALVICGIITSLIAPFLFPVIVRLMGT