Protein Info for DDA3937_RS08460 in Dickeya dadantii 3937

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 3 to 114 (112 residues), 65.7 bits, E=3e-21
• PF13704: Glyco_tranf_2_4
  • amino acids 9 to 83 (75 residues), 27.9 bits, E=1.5e-09
• PF13432: TPR_16
  • amino acids 185 to 226 (42 residues), 22.1 bits, 1.1e-07
• PF07719: TPR_2
  • amino acids 199 to 227 (29 residues), 25.1 bits, see alignment (E = 7.5e-09)
• PF13181: TPR_8
  • amino acids 200 to 226 (27 residues), 16.3 bits, see alignment (E = 5.3e-06)
  • amino acids 272 to 301 (30 residues), 13.9 bits, see alignment (E = 3.2e-05)
• PF13176: TPR_7
  • amino acids 201 to 226 (26 residues), 14.6 bits, see alignment (E = 1.8e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03737)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

• N-Glycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

See E0SK80 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DDA3937_RS08460 glycosyltransferase (Dickeya dadantii 3937)
MISVCMIIKNEARHLAGTLASIAAHFDDIVIVDTGSTDDSRAIASQFTTNIHDFEWVADF
SAARNASLNYARHDWVLVIDADEEIESIDIDALYALIKTHPQAIGRVERINYLDEGTDTT
TVRESINRLFRKDCYHYSGIIHEQVTPREISASPVPAFIAPIRLNHVGYKKEILQETDKV
ARNITLLKQALEMQPDDPYLLFQLGKSYYLKRDYSSAIDYFRQALRFETNFTYEYTEDLV
ETYGYALINQGDYATAMDILHYESHYSSTDFIFLKALILMNNGQLQNAVDLFIQCTKMPP
GNKEGVNAYKANYNVGVILECVGMKQKALEFYQKCGDYALARDGIQRLVH