Protein Info for DDA3937_RS08460 in Dickeya dadantii 3937

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00535: Glycos_transf_2" amino acids 3 to 114 (112 residues), 65.7 bits, see alignment E=3e-21 PF13704: Glyco_tranf_2_4" amino acids 9 to 83 (75 residues), 27.9 bits, see alignment E=1.5e-09 PF13432: TPR_16" amino acids 185 to 226 (42 residues), 22.1 bits, see alignment 1.1e-07 PF07719: TPR_2" amino acids 199 to 227 (29 residues), 25.1 bits, see alignment (E = 7.5e-09) PF13181: TPR_8" amino acids 200 to 226 (27 residues), 16.3 bits, see alignment (E = 5.3e-06) amino acids 272 to 301 (30 residues), 13.9 bits, see alignment (E = 3.2e-05) PF13176: TPR_7" amino acids 201 to 226 (26 residues), 14.6 bits, see alignment (E = 1.8e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03737)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK80 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DDA3937_RS08460 glycosyltransferase (Dickeya dadantii 3937)
MISVCMIIKNEARHLAGTLASIAAHFDDIVIVDTGSTDDSRAIASQFTTNIHDFEWVADF
SAARNASLNYARHDWVLVIDADEEIESIDIDALYALIKTHPQAIGRVERINYLDEGTDTT
TVRESINRLFRKDCYHYSGIIHEQVTPREISASPVPAFIAPIRLNHVGYKKEILQETDKV
ARNITLLKQALEMQPDDPYLLFQLGKSYYLKRDYSSAIDYFRQALRFETNFTYEYTEDLV
ETYGYALINQGDYATAMDILHYESHYSSTDFIFLKALILMNNGQLQNAVDLFIQCTKMPP
GNKEGVNAYKANYNVGVILECVGMKQKALEFYQKCGDYALARDGIQRLVH