Protein Info for DDA3937_RS08455 in Dickeya dadantii 3937

Annotation: flavodoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF00258: Flavodoxin_1" amino acids 6 to 73 (68 residues), 27.5 bits, see alignment E=4.7e-10 PF12724: Flavodoxin_5" amino acids 6 to 74 (69 residues), 34.6 bits, see alignment E=3.3e-12 PF03358: FMN_red" amino acids 38 to 123 (86 residues), 38.2 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 69% identical to FLDP_PSEAB: Flavodoxin FldP (fldP) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03736)

Predicted SEED Role

"Multimeric flavodoxin WrbA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK79 at UniProt or InterPro

Protein Sequence (184 amino acids)

>DDA3937_RS08455 flavodoxin family protein (Dickeya dadantii 3937)
MSKIAVVYYSGYGHTKLIAELVAESAKASLIAIDNNGDITDADWETLNAADGIIFGAPTY
MGNAPWQFKKFADASSKIWFTRAWQDKVFGGFVNSASLNGDKQVTLIYLQTLAAQHGGIW
VSLGQLPANALASTRNDANNLGGSGGALIQSPSDAGADAIPAGDLETAKLYGARVAEITR
RLHG