Protein Info for DDA3937_RS08255 in Dickeya dadantii 3937

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 25 to 52 (28 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 27 to 119 (93 residues), 88 bits, see alignment E=2.5e-29 PF00528: BPD_transp_1" amino acids 43 to 222 (180 residues), 70.3 bits, see alignment E=9.2e-24

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to ddd:Dda3937_00644)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJE5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DDA3937_RS08255 amino acid ABC transporter permease (Dickeya dadantii 3937)
MFDVLTILHDHSMLLLMGQYPNGPLGGVLCTLLISLLAVVLSFPLGVLVGLARLSPWRGL
RWAATAWVYTLRGIPLMMVVFWTYFCVPLLIGQNISGFSTMLCTLVIYESAYIAEIVRGG
IQALPHGQYEASRALGMSYLKTLRLVVLPQALFNSLPSLVSQLVSIIKDSTLGYVINVPE
LTYAANQVSNQLLTKPFQVFAIVALSYYIICFSLTWLANKLESYIANKRLNERPSQGEGQ
NSPLFLANRNLNKEAS