Protein Info for DDA3937_RS08075 in Dickeya dadantii 3937

Annotation: threo-3-hydroxy-L-aspartate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00291: PALP" amino acids 23 to 308 (286 residues), 288.4 bits, see alignment E=3.4e-90

Best Hits

Swiss-Prot: 68% identical to SRR_SCHPO: Serine racemase (SRR) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to ddd:Dda3937_02989)

MetaCyc: 68% identical to L-threo-3-hydroxy aspartate ammonia-lyase (Pseudomonas sp. T62)
Threo-3-hydroxyaspartate ammonia-lyase. [EC: 4.3.1.16]

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.16 or 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJA5 at UniProt or InterPro

Protein Sequence (322 amino acids)

>DDA3937_RS08075 threo-3-hydroxy-L-aspartate ammonia-lyase (Dickeya dadantii 3937)
MDPIVLPSYDDVVAASDRIAGYAHRTPLLTSRTVNDAFGAELYFKCENFQRTGAFKFRGA
MNALLQFTAEQKAAGVVAFSSGNHAQAIALSAKLLGMPATIVMPQDAPAAKIAATKGYGA
QVVTFDRYTQDREAIGRELAQQHGMTLIPPFDHPHIIAGQGTAAKELFEEVGELDALFVC
LGGGGLLSGSALSARRLSPGCRVYGVEPEAGNDGQQSFRSGRIVHIDTPHTLADGAQTQH
LGQYTFALIRAHVDDVLTVSDDELVAAMRFFAERMKMVVEPTGCLGFAAAQACQNELRGK
RVGVIVSGGNVDLARYGQLLAV