Protein Info for DDA3937_RS07480 in Dickeya dadantii 3937
Annotation: hydrogenase maturation factor HybG
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to YFRC_PROVU: Frd operon uncharacterized protein C from Proteus vulgaris
KEGG orthology group: K04653, hydrogenase expression/formation protein HypC (inferred from 100% identity to ddd:Dda3937_04116)MetaCyc: 54% identical to hydrogenase maturation factor HypC (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"[NiFe] hydrogenase metallocenter assembly protein HypC" in subsystem NiFe hydrogenase maturation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SHL4 at UniProt or InterPro
Protein Sequence (91 amino acids)
>DDA3937_RS07480 hydrogenase maturation factor HybG (Dickeya dadantii 3937) MCLGIPGQVVEWASADHQLAWVDVCGVRREVNVALVLDDGQPSSLIGQWVLVHVGFAMSR LDEQEARDTLEALRQMEEVESDVGVFLAKSV