Protein Info for DDA3937_RS07445 in Dickeya dadantii 3937

Annotation: hydrogenase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 PF00329: Complex1_30kDa" amino acids 43 to 159 (117 residues), 88.4 bits, see alignment E=8.7e-29 PF00374: NiFeSe_Hases" amino acids 224 to 292 (69 residues), 44.1 bits, see alignment E=2.3e-15 PF00346: Complex1_49kDa" amino acids 301 to 472 (172 residues), 140 bits, see alignment E=1.2e-44 amino acids 476 to 543 (68 residues), 40.3 bits, see alignment E=3e-14

Best Hits

Swiss-Prot: 74% identical to HYCE_ECOLI: Formate hydrogenlyase subunit 5 (hycE) from Escherichia coli (strain K12)

KEGG orthology group: K12142, hydrogenase-4 component G [EC: 1.-.-.-] (inferred from 100% identity to ddd:Dda3937_00733)

MetaCyc: 74% identical to hydrogenase 3 large subunit (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHK7 at UniProt or InterPro

Protein Sequence (575 amino acids)

>DDA3937_RS07445 hydrogenase large subunit (Dickeya dadantii 3937)
MINSSAATGTENLGADYVAHVRQQFPTAILEEERQTANQLTLTVKLHQLPEVVEYLYYQH
GGWLSVLFGNDERTLNGHFAVYYVLSMEQGEKCWVVVKALVNPTVPEFPSVTPRVPAAVW
GEREVRDMYGLIPVGLPDERRLVLPDDWPDDLYPLRKDAMDYRQRPAPTRDDESYTFINE
ATGDTRVVPIGPLHITSDEPGHFRLFVDGEQIIDADYRLFYVHRGMEKLAETRMGYNEVT
FLSDRVCGICGFTHSVAYTSSIENALGVVVPARAHTIRSILLEVERLHSHLLNIGLSSHF
VGFDTGFMQFFRVREKSMQIAEMLTGARKTYGLNLIGGIRRDILKEDRLKTIKLIREMRD
EVTQLTDMLLNTANMAQRTQGVGVLNRQVARDYSPVGPMIRASGFQRDVRVDHPFAGYLD
LPMELHHLDGGDVYSRVLVRVREVFTSLAMIEFGLDNMPDGPILNEHIHYQPHKFALGFT
EAPRGEDIHWSMTGDNQKLFRWRCRAATYANWPVLRFMLRGNTVSDAPLIIGSLDPCYSC
TDRVTLVDVRKKKVTTVPYKEIERYGLERTRSPLK