Protein Info for DDA3937_RS04890 in Dickeya dadantii 3937

Annotation: membrane-bound lytic murein transglycosylase MltC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF11873: Mltc_N" amino acids 30 to 190 (161 residues), 234.3 bits, see alignment E=6e-74 PF01464: SLT" amino acids 194 to 316 (123 residues), 110.3 bits, see alignment E=4.3e-36

Best Hits

Swiss-Prot: 85% identical to MLTC_PECAS: Membrane-bound lytic murein transglycosylase C (mltC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08306, membrane-bound lytic murein transglycosylase C [EC: 3.2.1.-] (inferred from 100% identity to ddd:Dda3937_03401)

MetaCyc: 76% identical to membrane-bound lytic murein transglycosylase C (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase C precursor (EC 3.2.1.-)" (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBT4 at UniProt or InterPro

Protein Sequence (360 amino acids)

>DDA3937_RS04890 membrane-bound lytic murein transglycosylase MltC (Dickeya dadantii 3937)
MKKLFALLLVAPLLISCSSKKGGENNEAFIKDTNAFDILMGQFANNIENIWGLNEVLIAG
PKDYVKYSDQYMTRSHVNFDAGTITIETISSTNYEASLRQAIITTLLMGDNASNTDLYSD
ANDIQISREPLLYGQVLDNTGQPIRWEGRAGNFADYLIQNKLQRRTAGMRVIWSVTIQLV
PNHLDQRAHKYLPMVRQASERYGIDASLILAIMQTESSFNPYAVSRSDALGLMQVVQHSA
GRDVFKMKGKWGQPSRSYLFDPENNIDTGTAYLSMLKNVYLSGIQDPTSQRYAVITAYNG
GAGSVLRVFSSDKDTAFGRINNMSPGEVYQTLTTRHPSAESRHYLYKVNTAQKNYRGYSR