Protein Info for DDA3937_RS04565 in Dickeya dadantii 3937

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03486: HI0933_like" amino acids 47 to 233 (187 residues), 27.3 bits, see alignment E=5.5e-10 PF07992: Pyr_redox_2" amino acids 47 to 234 (188 residues), 37 bits, see alignment E=9.6e-13 PF00890: FAD_binding_2" amino acids 47 to 488 (442 residues), 210.8 bits, see alignment E=1.5e-65 PF12831: FAD_oxidored" amino acids 47 to 230 (184 residues), 48.2 bits, see alignment E=3.7e-16 PF01134: GIDA" amino acids 47 to 239 (193 residues), 27.7 bits, see alignment E=5.3e-10 PF01266: DAO" amino acids 47 to 236 (190 residues), 44.7 bits, see alignment E=5e-15 PF13450: NAD_binding_8" amino acids 50 to 83 (34 residues), 23.4 bits, see alignment (E = 2.1e-08)

Best Hits

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to ddd:Dda3937_01443)

Predicted SEED Role

"Fumarate reductase flavoprotein subunit (EC 1.3.99.1)" in subsystem Succinate dehydrogenase (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB65 at UniProt or InterPro

Protein Sequence (519 amino acids)

>DDA3937_RS04565 FAD-dependent oxidoreductase (Dickeya dadantii 3937)
MVQYRKKLLAALCLSVLGITSVQASGPAEPAKSAEPAKPVELPKSADVVIIGAGAAGTAA
TMAAAEKGASVVLLEKQGVVGGTGNFAEGIFAANSTMQKRQGIVVTPDMAFKTIMEYSHW
MANPFVVRAFVNRSADTIEWVKSKGIKFEYIGPGGPGGMLTWHVIDGPGHGRHLIKTFHE
QFKDMKVTTLVKTAGKDLVMKDGKVAGVIAEGSDGKPFQIDAKAVIIATGGYANNKEMLQ
KYVAVPDTIMVGNVGKDGDGIKMAWKAGAKEEGMGVVQSYRPGLPDYAPNSQLLAAARQP
YLWVDQHGRRFTDESIVIIWPHAGNALAKAGGVMYSVFDEDARKHFVNDGIDVPIGEWVI
ANTKLVKFDDEFTKESQKNRGFVFKAATLDELAKQMGVDASVLKHTVDENNRFAAQKRDE
VFNKNMDYLRPMKTGPFYAVKMLPAALGTLGGVKINEKMEAISPAGNAVPGLYVTGNDAA
GMYGDTYDLLLGGGTFGFALNSGRMAAENALDYLRFTKK