Protein Info for DDA3937_RS03390 in Dickeya dadantii 3937

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details PF21085: CusS" amino acids 8 to 108 (101 residues), 25.4 bits, see alignment E=3.5e-09 TIGR01386: heavy metal sensor kinase" amino acids 9 to 461 (453 residues), 414.3 bits, see alignment E=3.5e-128 PF00672: HAMP" amino acids 188 to 241 (54 residues), 27 bits, see alignment 1.1e-09 PF26769: HAMP_PhoQ" amino acids 194 to 240 (47 residues), 27.2 bits, see alignment 7.9e-10 PF00512: HisKA" amino acids 246 to 310 (65 residues), 51 bits, see alignment E=3.1e-17 PF02518: HATPase_c" amino acids 355 to 464 (110 residues), 108.8 bits, see alignment E=5.3e-35

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to ddd:Dda3937_02279)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLS3 at UniProt or InterPro

Protein Sequence (474 amino acids)

>DDA3937_RS03390 heavy metal sensor histidine kinase (Dickeya dadantii 3937)
MLIPRNFPITLRLTLYFSLAMSLVLYSVSGLLYSTMRNQLSQKDEDELRSTLRFQQEIAA
TISERQGPKDLWQQELFEFVARQERLSLRIISPDGKVWAQSKNMRVPQRDFPAPSSEFRY
SSWRYRAHEASEKYLIASTDFVLKDNQPWLVQAALNVSKNNEIIEDYWKRMQIAAALSII
IFSAIGYWLARKGLLPLRTMSREIEHIHAEDLHTRLSTQRWPSELNTLAASFDGMMTRLE
ASFKQLSRFSSDIAHELRGPINNLISAASVTQSKTRSQEEYRETLAAIVEEGERLSRMIS
SMLFLARADNSREPLNVEQLDSATEFARLINFYDILAEEKDIELSSEGDAVFYADPIHVQ
RALANLLSNALRHTPAGGKILLSAANHNGKVWLSVIDNGEGISADHLPHIFDRFYRVDDA
RSNAENTGLGLALVKTIAEMHGGKIQVASEEGKGSCFTLVLPARKDDIVNLTKL