Protein Info for DDA3937_RS02595 in Dickeya dadantii 3937

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 250 to 281 (32 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 8 to 164 (157 residues), 60.9 bits, see alignment E=7.8e-21

Best Hits

KEGG orthology group: None (inferred from 97% identity to pwa:Pecwa_0590)

Predicted SEED Role

"Putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>DDA3937_RS02595 glycosyltransferase (Dickeya dadantii 3937)
MSDKPFISVSIKTFNEAECIEKTIDSIRRHIADYPHKIIVADSLSTDNTQQLASTKGVTV
VSLTEPSERCCGVGHQLGYLYSQGDYLLLMDGDMELEDGFIEQGIAFLTAHPDYAGVAGT
VEMDGAANYEFTSRKQRLHKIYPLGDCGHLGGGGLYRRSAIEKIGYLTNRSLHGYEEAEL
GIRLRHAQYKLHRLNVPYFRHTSYTMPTYKMLQYRWRNGFLWAPGELLRSAWGMPYFREA
LHIVKNEAVFAVYLLALVMSLLTFNAVVIGAALLPLLAFVALKTIKNRSLLNGLQSVMNL
AVFSAGLIKGLTRPVRDPMTPPDSKVIHE