Protein Info for DDA3937_RS02090 in Dickeya dadantii 3937

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF01047: MarR" amino acids 3 to 60 (58 residues), 31.5 bits, see alignment E=2.7e-11 PF13412: HTH_24" amino acids 3 to 50 (48 residues), 67.1 bits, see alignment E=1.6e-22 PF13404: HTH_AsnC-type" amino acids 6 to 44 (39 residues), 54 bits, see alignment E=2.4e-18 PF01037: AsnC_trans_reg" amino acids 67 to 146 (80 residues), 86.7 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 38% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01317)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJ07 at UniProt or InterPro

Protein Sequence (160 amino acids)

>DDA3937_RS02090 Lrp/AsnC family transcriptional regulator (Dickeya dadantii 3937)
MKLNLTDIKILTLLQKDARITNQTLAEQIGMSPSPCWRKVRKLEEEDVIQSYRAVLDRRK
IGLGVMVFVRVTIDSHSEAQARKFEQEVTDLEDVVACYSMGGDADFLLQVVSRDLDSYAE
FAMSVIRRLPGIKEMQSMFVLKEIKPFATFPIKKPLKTPQ