Protein Info for DDA3937_RS00880 in Dickeya dadantii 3937

Annotation: ferredoxin--NADP(+) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 77% identical to FENR_SHIFL: Flavodoxin/ferredoxin--NADP reductase (fpr) from Shigella flexneri

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 100% identity to ddd:Dda3937_03874)

MetaCyc: 76% identical to flavodoxin/ferredoxin-NADP+ reductase (Escherichia coli K-12 substr. MG1655)
FLAVONADPREDUCT-RXN [EC: 1.19.1.1]

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
ethene biosynthesis V (engineered) (18/25 steps found)
oxygenic photosynthesis (11/17 steps found)
NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (1/4 steps found)
photosynthesis light reactions (1/4 steps found)
superpathway of photosynthetic hydrogen production (2/6 steps found)

KEGG Metabolic Maps

Photosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2 or 1.19.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFM8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>DDA3937_RS00880 ferredoxin--NADP(+) reductase (Dickeya dadantii 3937)
MAEWVTGKVIQVEHWTENLFSLRLEAPVAPFTAGQFAKLALELGGERVQRAYSYVNAPSD
TLLEFYLVNVPDGKLSPHLHRCQPGDEVLVTQEAAGFFVLGEIPDCDTLWMLATGTAIGP
YLSILQEGRGLERFKHIVLVHAARFARDLSFLPLMQQLEQRYDGKLRIQTVVSREEQPGS
LTGRVPALIESGALEAAVGLSMDAATSHVMLCGNPQMVRDTQQLLKDTRQMSKHLRRRPG
HMTSEHYW