Protein Info for CCNA_03999 in Caulobacter crescentus NA1000 Δfur

Annotation: cell surface polysaccharide synthesis protein, GtrA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details PF04138: GtrA" amino acids 23 to 137 (115 residues), 69.6 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: None (inferred from 34% identity to met:M446_3397)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1C9ULU8 at UniProt or InterPro

Protein Sequence (147 amino acids)

>CCNA_03999 cell surface polysaccharide synthesis protein, GtrA family (Caulobacter crescentus NA1000 Δfur)
MIFTLAGPIWRLLPEGFRELILYGLVSAAALAVDWGLLVVLTWAGVDYLLASGVGFCFGI
GVAYVLSIRLVFAHRPIADRWREFTGFLGVGLAGLLLTQGLMIVGVEAFGMAPASAKGPT
ACLVFLFNFTVRRALLFRAPRADIARS