Protein Info for CCNA_03921 in Caulobacter crescentus NA1000 Δfur
Annotation: UDP-glucose 6-dehydrogenase related protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Predicted SEED Role
"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)
MetaCyc Pathways
- colanic acid building blocks biosynthesis (10/11 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
- UDP-α-D-xylose biosynthesis (2/2 steps found)
- UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
- UDP-sugars interconversion (4/9 steps found)
- teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
KEGG Metabolic Maps
- Ascorbate and aldarate metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.22
Use Curated BLAST to search for 1.1.1.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3IWB0 at UniProt or InterPro
Protein Sequence (51 amino acids)
>CCNA_03921 UDP-glucose 6-dehydrogenase related protein (Caulobacter crescentus NA1000 Δfur) MRAAMIGTGYVGLVSGACFADFGHVVTCIDKDPPEDRAAGEGRNPDLRAGP