Protein Info for CCNA_02530 in Caulobacter crescentus NA1000 Δfur

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF05401: NodS" amino acids 234 to 326 (93 residues), 29.8 bits, see alignment E=1.6e-10 PF13489: Methyltransf_23" amino acids 238 to 340 (103 residues), 44.1 bits, see alignment E=5.7e-15 PF13847: Methyltransf_31" amino acids 242 to 338 (97 residues), 32.1 bits, see alignment E=2.6e-11 PF13649: Methyltransf_25" amino acids 245 to 333 (89 residues), 46.6 bits, see alignment E=1.3e-15 PF08242: Methyltransf_12" amino acids 245 to 335 (91 residues), 55.7 bits, see alignment E=2.1e-18 PF08241: Methyltransf_11" amino acids 245 to 337 (93 residues), 48.9 bits, see alignment E=2.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2448)

Predicted SEED Role

"FIG00481610: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA07 at UniProt or InterPro

Protein Sequence (401 amino acids)

>CCNA_02530 SAM-dependent methyltransferase (Caulobacter crescentus NA1000 Δfur)
MDADHLQRIFDEAVQAHGEGRLDEAEAGFRAVLEVLPHEGEALFGLGLTLMGLRRFSEAI
PPLKAAAAEPGAEPVRFLCLAQGLYMTGAFAEAAETFAAVAHQDGFNDGARLTWARSAAY
AALDDTDADSALALYGQIAGPVAEDLDTVAREGFSTLVAFERLAAARKLGQWLEARAPDD
AIRAHELRVLTDPQIDRAPPAYVEALFDAFAERFDHQLLDNLEYQTPTLLAEMIGVADRR
FTHMLDLGCGTGLAGPPLRARVARLTGVDLSTAMLAKAAERGGYDALVHAEAVAFLRETP
DRFDLIVAADVFSYLGDLGDILAAAAGALSDDGLLAFSVEQGETWWRLLPSARYAHGDDY
VRAAGAGVGLEVIQHRQTPLRRQADAAIPGGLYVLRKIRAA