Protein Info for CCNA_02320 in Caulobacter crescentus NA1000 Δfur

Annotation: 2'-deoxycytidine 5'-triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF06559: DCD_N" amino acids 7 to 169 (163 residues), 251.6 bits, see alignment E=5.1e-79 PF22769: DCD" amino acids 9 to 167 (159 residues), 129.7 bits, see alignment E=1.5e-41 amino acids 171 to 310 (140 residues), 84.7 bits, see alignment E=1.1e-27 PF22569: DCD_C" amino acids 177 to 337 (161 residues), 247.1 bits, see alignment E=1.3e-77

Best Hits

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to ccs:CCNA_02320)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8S3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CCNA_02320 2'-deoxycytidine 5'-triphosphate deaminase (Caulobacter crescentus NA1000 Δfur)
MTDAHSAGILPCQTIEELIAEEAITSATPFDVDQVQPASLDLRLGARAWRIRASFLPGLS
RRVPERLKDVAMHELDLTKGAVLEKGCVYIAEIQERLALPMTVSARGNPKSSTGRVDVFV
RLLTDHSRAFDDVDAGYTGPLYIEIAPQTFSVLVRAGTRLNQLRLKRGEPAKLATRSVGV
DLLSETGIVGFRGRRHAGVVDLDHEDGHDPRDFWEPLEARRGELLLDPGEFYILASKDDI
EIPVLEAAEMTPIDPSVGEFRVHYAGFFDPGFGTEEAAAVGSKGVLEVRSHETPFLLEDG
QTVARLVYEPLTARPARLYGEGGSHYQRQGLKLSKHFKAWR