Protein Info for CCNA_02074 in Caulobacter crescentus NA1000 Δfur

Annotation: IAA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13673: Acetyltransf_10" amino acids 46 to 139 (94 residues), 33.2 bits, see alignment E=7.1e-12 PF00583: Acetyltransf_1" amino acids 48 to 134 (87 residues), 56.4 bits, see alignment E=5.5e-19 PF13508: Acetyltransf_7" amino acids 52 to 135 (84 residues), 45.1 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 45% identical to YSNE_BACSU: Uncharacterized N-acetyltransferase YsnE (ysnE) from Bacillus subtilis (strain 168)

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to ccs:CCNA_02074)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9G2 at UniProt or InterPro

Protein Sequence (156 amino acids)

>CCNA_02074 IAA acetyltransferase (Caulobacter crescentus NA1000 Δfur)
MPKPQLRIIAGDFEDPRIIALLAHHFATMRSTGPEESCHVMPLGTMRQADLDFFAAWDGD
ALAGFGAVKQLGDGHGEIKSMHTAAAYRGRGVGQAVLDHLSTHARALGLQRLSLETGAGD
FFVPARAMYARNGFQTCDPFGDYKPDPNSVFMTRML