Protein Info for CCNA_01525 in Caulobacter crescentus NA1000 Δfur

Annotation: flagellar biosynthesis repressor flbT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF07378: FlbT" amino acids 3 to 126 (124 residues), 152.8 bits, see alignment E=2.3e-49

Best Hits

Swiss-Prot: 100% identical to FLBT_CAUVN: Probable flagellum biosynthesis repressor protein FlbT (flbT) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06601, flagellar protein FlbT (inferred from 100% identity to ccs:CCNA_01525)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H5S2 at UniProt or InterPro

Protein Sequence (141 amino acids)

>CCNA_01525 flagellar biosynthesis repressor flbT (Caulobacter crescentus NA1000 Δfur)
MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPV
MMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLI
EYEDERLGHVSSGVSAGGDAG