Protein Info for CCNA_00783 in Caulobacter crescentus NA1000 Δfur

Annotation: secreted protease precursor sapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 PF00413: Peptidase_M10" amino acids 101 to 208 (108 residues), 30.8 bits, see alignment E=5.1e-11 PF08548: Peptidase_M10_C" amino acids 265 to 388 (124 residues), 144.4 bits, see alignment E=7.5e-46 PF00353: HemolysinCabind" amino acids 349 to 383 (35 residues), 27.1 bits, see alignment (E = 6.4e-10) PF19198: RsaA_NTD" amino acids 485 to 657 (173 residues), 270.1 bits, see alignment E=1.9e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0746)

Predicted SEED Role

"Secreted alkaline metalloproteinase (EC 3.4.24.-), PrtA/B/C/G homolog" in subsystem Protein secretion by ABC-type exporters (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6K3 at UniProt or InterPro

Protein Sequence (658 amino acids)

>CCNA_00783 secreted protease precursor sapA (Caulobacter crescentus NA1000 Δfur)
MCSQCERYGLNLHGDDVAPAVSGGEGPYAFVDADSRVGTVDGKKSLTVPEAALQLLRSEP
GWSNQFLVPATVTYAFRATAPASMPSDTGGFSQFNAAQILQAEKALQAWSDVANITFVRV
GQGTSGEAAYSDNASILFANFSTGSEGSAGFAYYPGNPAASSRSGDVWIKSTAGYNTNPT
GSNYGGMVLVHELGHAIGIAHPSEYNASADDTLTYAANATYYQDSRQYTVMSYFSEANTG
GSFGGAYASSPLLDDIAAAQLAYGANMTTRTGDTVYGFNSTAGREWFAATSSSTRLVFAV
WDAGGVDTLDFSGYRVAQTIDLRAGYFSSVGGLKGNVTIAMNAVIENAIGGSAADTINGN
AVDNRLTGGAGADILDGGRGVDTAVFSGAYGNYTLTAATNGAWSVLDRVGTDATDTLANI
EFLAFTDRTVTLVDSRVATAISNILRLQTFSASAEPLSKSLAASMAAGASHSDAIGQVSK
TALSTSGVAVLAYQFFTGKTPTAAGMDYLVNPDGVNANNLNSAYYQSFNLENRYINFAVN
LGKIGEGATKFLADYGGLSLFDATRKAYATIFGLTPTDDKVRALIDGRTDYFAAYGQDGP
NGQGTKAAMVGWLMAEAGKADIGVYAKSAGAFFADQATKNVYGVDLIGVYAKPEYNLI